PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT26586
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB_related
Protein Properties Length: 751aa    MW: 82534.1 Da    PI: 4.8242
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT26586genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.65.7e-084385347
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +WT +E+e + +a +q G++ +++I  +++  +   q++++++ +
         EMT26586 43 AWTRQEEESFFNALRQVGKN-FEKITLRVQ-SKNKDQVRHYYYRL 85
                     6*****************99.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.56E-93889IPR009057Homeodomain-like
PROSITE profilePS5129312.5823990IPR017884SANT domain
SMARTSM007179.0E-64088IPR001005SANT/Myb domain
CDDcd001671.01E-54386No hitNo description
Gene3DG3DSA:1.10.10.601.1E-44388IPR009057Homeodomain-like
PfamPF002496.8E-64385IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016310Biological Processphosphorylation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0016301Molecular Functionkinase activity
Sequence ? help Back to Top
Protein Sequence    Length: 751 aa     Download sequence    Send to blast
MEKEVCEEMS PPPQPVDLPD ATPPSASDPS QKPAKKATRQ WAAWTRQEEE SFFNALRQVG  60
KNFEKITLRV QSKNKDQVRH YYYRLVRRMK KLLGPGFSLD ARNSKDTIAA MLRWRLELWI  120
VIVTYKSCGI FCSNADYTSG GNQLIKDRKR TRRKCSLGDT RLSSSSPVLS KTPGNQSFAV  180
GLLPMDAQNG SKGASSKGAF MKRVADPNSN KSGVIRGDLS ATRTVRQKRR AGGAGACAAY  240
KKWERAAMAG VSLVADAAEE LERKMTTQNL SCNADATVLA SSPNNVSTVD DMGTNHMKEA  300
DPQAPSKLKL QLFPINEATR KALEKDDHNP HLELTLSSKK KMSSVLEHLN RKWGNSNIAC  360
GELVLFPYCA HQEDLATYQR WTTQDTVAVA DVFFSVNSPS IFRLRYGWFS LAELEAGLSE  420
ISLTRFENCM IPEDIQVKSS SEACVQKDGT LPSDFTSEQS SNNSKDQSPL LLGTPSSTGK  480
NAAEEPSINT FPSQSGDHNQ EQVPANKAFE VDPQMDCLAI SEVDWADTLT DISVGYLLTE  540
ASKAANLDCE VTSIAQNPLF DENPCSYDSF DAAVALHASR YQAAEQPAHT SNSTIWGAEE  600
TCDEFSFMLA TARKQQGLNT SASSPPDSDN EVHSSNSEGF QGFLQDLAGG DTPGNPCADD  660
VKAMEELCAR SPPQSDNDFG LKDQPLDDVF WPESLGPLDL DIPPIRSLAD EFILGDSQNS  720
WSRMMENSMD AFRNMSFFVS DNNDSVLPPI M
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519290.0JF951929.1 Triticum aestivum clone TaMYB46 MYB-related protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010228893.10.0PREDICTED: TSL-kinase interacting protein 1-like
TrEMBLG9DR920.0G9DR92_WHEAT; MYB-related protein
TrEMBLM8CSB50.0M8CSB5_AEGTA; TSL-kinase interacting protein 1
STRINGMLOC_10030.40.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54783643
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36960.21e-139TSL-kinase interacting protein 1